User Tools

Site Tools


purification:expression_and_purification_of_smprmt3_184-553

Differences

This shows you the differences between two versions of the page.

Link to this comparison view

Both sides previous revisionPrevious revision
Next revision
Previous revision
purification:expression_and_purification_of_smprmt3_184-553 [2016/10/28 13:42] marechanpurification:expression_and_purification_of_smprmt3_184-553 [2023/01/20 13:33] (current) – removed marechan
Line 1: Line 1:
-**__Expression & purification of 6his-SmPRMT3(1-553)__** 
  
-**Construct** 
- 
-MGSSHHHHHHSSGTGSGENLYFQGHMSPCDQSSNYDLDMEPNDSSYFGSYGHFEIHGEMINDRVRTESYVNFILSNAEKYFKHKIILDVGSGSGILSIIAAQAGASHVYGVEAADEIYAASHETLRVNNLLERVTFIHGQAESVELPVKKVDVIISEWMGYFLFFESMLDSVLKMASKYLSRDGHIFPRHYTLNLLGVQCSEQLRKRRLEHWNNVYGYNMPALRRAALSEAHVLNLTNEHVTPPISPITILTQSFELVALDLDDMHRNRIYNLSNHCSLLCEQKFHLTIQPTTDINNNSSSSSYELDAIVGYFDVRFDDDADCKVEFSTSPTTPLTHWKQTLLFLDKPIRVKPGDKISGIITIRRATTDNRGLEINLLIGETENSLEIKQTFDLIG 
- 
-Length = 396 AA 
- 
-Molecular weight = 44782.3 Da 
- 
-pI 5.66 
- 
-ξ(red) 40340 L.M<sup>-1</sup> 
- 
-**Expresion** 
- 
-Grow pnEAvH_SmPRMT3-184 BL21(DE3) transformants on an LB-Amp plate (1 plate/L culture), overnight 37°C. Resuspend cells in LB medium (5 mL/plate) and innoculate liquide **2X** LB medium + 100 μg/mL<sup>-1</sup> Ampicilline. Grow culture(s) at 37°C, 200 rpm and measure OD600 every 20 minutes. When OD600 reaches 0.4, set temperature to 20°C. When OD600 reaches 0.6 to 0.8, induce 6his-SmPRMT3(184-553) with 1 mM IPTG and leave the cultures to express the protein overnight. 
- 
-**Purification** (for 3L) 
- 
-Pellet cells by centrifugation (4000 rpm, 45 minutes), then resuspend pellets in 200 mL Lysis buffer 
- 
-**Buffers** 
- 
-__Lysis buffer:__ 50 mM BTP pH9, 250 mM NaCl, 1 mM TCEP, 0.01% NP40, Complete<sup>®</sup>-EDTA free protease inhibitor cocktail (1 pill / 50 mL) 
purification/expression_and_purification_of_smprmt3_184-553.1477662145.txt.gz · Last modified: (external edit)