User Tools

Site Tools


purification:expression_and_purification_of_smprmt3_184-553

Differences

This shows you the differences between two versions of the page.

Link to this comparison view

Both sides previous revisionPrevious revision
purification:expression_and_purification_of_smprmt3_184-553 [2016/10/28 14:16] marechanpurification:expression_and_purification_of_smprmt3_184-553 [2023/01/20 13:33] (current) – removed marechan
Line 1: Line 1:
-**__Expression & purification of 6his-SmPRMT3(1-553)__** 
  
-**Construct** 
- 
-MGSSHHHHHHSSGTGSGENLYFQGHMSPCDQSSNYDLDMEPNDSSYFGSYGHFEIHGEMINDRVRTESYVNFILSNAEKYFKHKIILDVGSGSGILSIIAAQAGASHVYGVEAADEIYAASHETLRVNNLLERVTFIHGQAESVELPVKKVDVIISEWMGYFLFFESMLDSVLKMASKYLSRDGHIFPRHYTLNLLGVQCSEQLRKRRLEHWNNVYGYNMPALRRAALSEAHVLNLTNEHVTPPISPITILTQSFELVALDLDDMHRNRIYNLSNHCSLLCEQKFHLTIQPTTDINNNSSSSSYELDAIVGYFDVRFDDDADCKVEFSTSPTTPLTHWKQTLLFLDKPIRVKPGDKISGIITIRRATTDNRGLEINLLIGETENSLEIKQTFDLIG 
- 
-Length = 396 AA 
- 
-Molecular weight = 44782.3 Da 
- 
-pI 5.66 
- 
-ξ(red) 40340 L.M<sup>-1</sup> 
- 
-**Expresion** 
- 
-Grow pnEAvH_SmPRMT3-184 BL21(DE3) transformants on an LB-Amp plate (1 plate/L culture), overnight 37°C. Resuspend cells in LB medium (5 mL/plate) and innoculate liquide **2X** LB medium + 100 μg/mL<sup>-1</sup> Ampicilline. Grow culture(s) at 37°C, 200 rpm and measure OD600 every 20 minutes. When OD600 reaches 0.4, set temperature to 20°C. When OD600 reaches 0.6 to 0.8, induce 6his-SmPRMT3(184-553) with 1 mM IPTG and leave the cultures to express the protein overnight. 
- 
-**Purification** (for 3L) 
- 
-**1/** Pellet cells by centrifugation (4000 rpm, 45 minutes), then resuspend pellets in cold 200 mL Lysis buffer. On ice, sonicate cell suspension 3 times for 5 minutes (amplitude 60, frequency 0.5), then clarify the lysate (41657G, 45 minutes, 4°C). 
- 
-**2/** Incubate crude extract with 5 mL of equilibrated Talon<sup>®</sup> metal-affinity resin for 2h, 4°C under soft agitation. Spin down beads (233G, 2 minutes, 4°C) and discard supernatant. //store 5 μL for SDS-PAGE analysis.// resuspend beads in 10 mL cold Talon wash buffer and load them on a clean column. Wash the resin with 40 mL Talon wash buffer (Total = 50 mL = 10V column). //store 10 μL for SDS-PAGE analysis.// In the column, incubate the resin in 7 mL cold Talon elution buffer, 15 minutes, 4°C under soft agitation, then store the eluate on ice. Repeat this step once then pass the remaining buffer through the column to get remaining eluate. //store 5 μL for SDS-PAGE analysis.// Regenerate the column with 20 mM MES pH5, 300 mM NaCl. //store 10 μL for SDS-PAGE analysis.// 
- 
-**3/**  
- 
- 
-**Buffers** 
- 
-__Lysis buffer (200 mL):__ 50 mM BTP pH9, 250 mM NaCl, 1 mM TCEP, 0.01% NP40, Complete<sup>®</sup>-EDTA free protease inhibitor cocktail (1 pill / 50 mL) 
- 
-__Talon wash buffer (100 mL):__ 50 mM BTP pH9, 250 mM NaCl, 1 mM TCEP, 10 mM imidazole 
- 
-__Talon elution buffer (20 mL):__ 50 mM BTP pH9, 250 mM NaCl, 1 mM TCEP, 150 mM imidazole 
- 
-__Dilution buffer (180 mL):__ 20 mM BTP pH9, 1 mM TCEP, 1 mM EDTA 
- 
-__ANX buffer (200 mL):__ 20 mM BTP pH9, 25 mM NaCl, 1 mM TCEP, 1 mM EDTA 
- 
-__Gradient buffer (100 mL):__ 20 mM BTP pH9, 1 M NaCl, 1 mM TCEP, 1 mM EDTA 
- 
-__GF buffer (350 mL):__ 20 mM BTP pH9, 50 mM NaCl, 1 mM TCEP, 1 mM EDTA 
purification/expression_and_purification_of_smprmt3_184-553.1477664186.txt.gz · Last modified: (external edit)