Differences

This shows you the differences between two versions of the page.

--- purification:tev [2016/07/13 15:03] – created bonnefon
+++ purification:tev [2023/11/01 20:19] (current) – external edit 127.0.0.1
@@ Line 1: / Line 1: @@
-In-house TEV production
+===== In-house TEV production =====
-[[https://www.addgene.org/8827/|pRK792 plasmid]] - MBP-TEV, S219V mutant
+----
+==== Clones ====
+[[https://www.addgene.org/8827/|pRK792 plasmid]] - His-TEV(S219V)-Arg - Waugh
+**Sequence**
+<q>G**HHHHHHH**GESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFM__V__KPEEPFQPVKEATQLMN**RRRRR**</q>
+His-TEV(L35V/S135G/S219V)-Arg - Cabrita(([[http://onlinelibrary.wiley.com/doi/10.1110/ps.072822507/abstract;jsessionid=4269BED8C9677045F562FB78F91A872F.f04t02|Cabrita et al. (2007) Protein Science 16, 2360-2367]]))
 His-TEV plasmid - Birck
@@ Line 7: / Line 16: @@
 pBS2440 optimized TEV plamsid - Seraphin
+----
+==== Protocols ====
+[[purification:tev:W_protocol|Waugh protocol]]
+[[purification:tev:C_protocol|Cabrita protocol]]
+[[purification:tev:B_protocol|Birck protocol]]
-Waugh protocol
+[[purification:tev:S_protocol|Seraphin protocol]]
-Birck protocol
-Seraphin protocol
+[[purification:tev:FAQ|TEV FAQ]]