User Tools

Site Tools


purification:expression_and_purification_of_smprmt3_184-553

This is an old revision of the document!


Expression & purification of 6his-SmPRMT3(1-553)

Construct

MGSSHHHHHHSSGTGSGENLYFQGHMSPCDQSSNYDLDMEPNDSSYFGSYGHFEIHGEMINDRVRTESYVNFILSNAEKYFKHKIILDVGSGSGILSIIAAQAGASHVYGVEAADEIYAASHETLRVNNLLERVTFIHGQAESVELPVKKVDVIISEWMGYFLFFESMLDSVLKMASKYLSRDGHIFPRHYTLNLLGVQCSEQLRKRRLEHWNNVYGYNMPALRRAALSEAHVLNLTNEHVTPPISPITILTQSFELVALDLDDMHRNRIYNLSNHCSLLCEQKFHLTIQPTTDINNNSSSSSYELDAIVGYFDVRFDDDADCKVEFSTSPTTPLTHWKQTLLFLDKPIRVKPGDKISGIITIRRATTDNRGLEINLLIGETENSLEIKQTFDLIG

Length = 396 AA

Molecular weight = 44782.3 Da

pI 5.66

ξ(red) 40340 L.M-1

Expresion

Grow pnEAvH_SmPRMT3-184 BL21(DE3) transformants on an LB-Amp plate (1 plate/L culture), overnight 37°C. Resuspend cells in LB medium (5 mL/plate) and innoculate liquide 2X LB medium + 100 μg/mL-1 Ampicilline. Grow culture(s) at 37°C, 200 rpm and measure OD600 every 20 minutes. When OD600 reaches 0.4, set temperature to 20°C. When OD600 reaches 0.6 to 0.8, induce 6his-SmPRMT3(184-553) with 1 mM IPTG and leave the cultures to express the protein overnight.

Purification (for 3L)

1/ Pellet cells by centrifugation (4000 rpm, 45 minutes), then resuspend pellets in cold 200 mL Lysis buffer. On ice, sonicate cell suspension 3 times for 5 minutes (amplitude 60, frequency 0.5), then clarify the lysate (41657G, 45 minutes, 4°C).

2/ Incubate crude extract with 5 mL of equilibrated Talon® metal-affinity resin for 2h, 4°C under soft agitation. Spin down beads (233G, 2 minutes, 4°C) and discard supernatant (store 5 μL for SDS-PAGE analysis).

3/

Buffers

Lysis buffer (200 mL): 50 mM BTP pH9, 250 mM NaCl, 1 mM TCEP, 0.01% NP40, Complete®-EDTA free protease inhibitor cocktail (1 pill / 50 mL)

Talon wash buffer (100 mL): 50 mM BTP pH9, 250 mM NaCl, 1 mM TCEP, 10 mM imidazole

Talon elution buffer (20 mL): 50 mM BTP pH9, 250 mM NaCl, 1 mM TCEP, 150 mM imidazole

Dilution buffer (180 mL): 20 mM BTP pH9, 1 mM TCEP, 1 mM EDTA

ANX buffer (200 mL): 20 mM BTP pH9, 25 mM NaCl, 1 mM TCEP, 1 mM EDTA

Gradient buffer (100 mL): 20 mM BTP pH9, 1 M NaCl, 1 mM TCEP, 1 mM EDTA

GF buffer (350 mL): 20 mM BTP pH9, 50 mM NaCl, 1 mM TCEP, 1 mM EDTA

purification/expression_and_purification_of_smprmt3_184-553.1477663266.txt.gz · Last modified: (external edit)